Saltar al contenido
Merck
Todas las fotos(3)

Documentos

SAB1400208

Sigma-Aldrich

Anti-SLC25A3 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Sinónimos:

Anti-OK/SW-cl.48, Anti-PHC

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunofluorescence: suitable
western blot: 1 μg/mL

Nº de acceso UniProt

Q00325

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC25A3(5250)

Descripción general

Solute carrier family 25 member 3 (SLC25A3) gene codes for mitochondrial phosphate carrier (PiC) protein. SLC25A3/ PiC protein belongs to the mitochondrial-carrier family. PiC consists of six transmembrane segments, 3-fold symmetry, and an N and C termini. The SLC25A3 gene is located on human chromosome 12q23.1.

Inmunógeno

SLC25A3 (NP_002626.1, 1 a.a. ~ 361 a.a) full-length human protein.

Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

Aplicación

Anti-SLC25A3 antibody produced in mouse has been used in immunoblotting.

Acciones bioquímicas o fisiológicas

Solute carrier family 25 member 3 (SLC25A3) helps in the transportation of inorganic phosphate into the mitochondrial matrix. Heterozygous mutations in the SLC25A3 gene might be related in vivo with respiratory distress and hypertrophic cardiomyopathy. Assays in Lactococcus lactis confirm the role of SLC25A3 as a copper transporter.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Johannes A Mayr et al.
American journal of human genetics, 80(3), 478-484 (2007-02-03)
The mitochondrial phosphate carrier SLC25A3 transports inorganic phosphate into the mitochondrial matrix, which is essential for the aerobic synthesis of adenosine triphosphate (ATP). We identified a homozygous mutation--c.215G-->A (p.Gly72Glu)--in the alternatively spliced exon 3A of this enzyme in two siblings
Erin L Seifert et al.
The Journal of biological chemistry, 291(50), 26126-26137 (2016-10-27)
The relevance of mitochondrial phosphate carrier (PiC), encoded by SLC25A3, in bioenergetics is well accepted. However, little is known about the mechanisms mediating the cellular impairments induced by pathological SLC25A3 variants. To this end, we investigated the pathogenicity of a
Aren Boulet et al.
The Journal of biological chemistry, 293(6), 1887-1896 (2017-12-15)
Copper is required for the activity of cytochrome c oxidase (COX), the terminal electron-accepting complex of the mitochondrial respiratory chain. The likely source of copper used for COX biogenesis is a labile pool found in the mitochondrial matrix. In mammals

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico