MSST0063

SILu^™Prot IGF-1, Insulin Growth Factor -1 human

recombinant, expressed in E. coli, SIL MS Protein Standard, ¹⁵N-labeled

• Sinónimos: IGF-A, Human, Insulin Growth Factor-I, Human, Insulin-Like Growth Factor-I, Human, Insulin-like growth factor I, Myotrophin, SM-C, Somatomedin 1, Sulfation Factor C, rhIGF-I
• Código UNSPSC: 23201100
• NACRES: NA.12

Propiedades

• recombinante: expressed in E. coli
• Nivel de calidad: 200
• Análisis: ≥95% (SDS-PAGE)
• formulario: lyophilized
• potencia: ≥97% (Heavy amino acids incorporation efficiency by MS)
• idoneidad: suitable for mass spectrometry (standard)
• Nº de acceso UniProt: P05019 (Gly49-Ala118)
• Condiciones de envío: ambient
• temp. de almacenamiento: −20°C

Descripción

Descripción general

SILu^™Prot IGF-1 is a recombinant, stable ¹⁵N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILu^™Prot IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

Acciones bioquímicas o fisiológicas

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Secuencia

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Forma física

Supplied as a lyophilized powder containing tris buffered saline and methionine

Información legal

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable