This product is a lyophilized powder. The purity and protein content per vial is reported on the lot specific Certificate of Analysis. Please see the link below to review the product datasheet which includes preparation instructions: https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/146/652/msqc19dat.pdf. Please see the link below to review a sample Certificate of Analysis: https://www.sigmaaldrich.com/certificates/COFA/MS/MSQC19/MSQC19-100UG______SLCD2802__.pdf
Seleccione un Tamaño
Acerca de este artículo
Saltar a
recombinant
expressed in CHO cells
assay
≥90% (SDS-PAGE)
form
solid
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
Categorías relacionadas
1 of 4
Este artículo | |||
|---|---|---|---|
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| form solid | form solid | form - | form solid |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
| assay ≥90% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) |
| suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability - | suitability suitable for mass spectrometry |
General description
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Other Notes
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
Clase de almacenamiento
11 - Combustible Solids
wgk
WGK 3
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Contenido relacionado
Instructions
-
What is the concentration and solubility of this product?
1 respuesta-
¿Le ha resultado útil?
-
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico


