Saltar al contenido
Merck

Saltar a

M1882

Myoglobin from equine heart

≥90% (SDS-PAGE), essentially salt-free, lyophilized powder

Myoglobin from equine heart
1 de 1 reseñadores recibieron un producto de muestra o participaron en una promoción

Sinónimos:

Myoglobin from horse heart

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas
A ustedes/SKUDisponibilidadPrecio
250 mg
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
111,00 €
1 g
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
356,00 €
5 g
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
1420,00 €
10 g
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
2470,00 €

Acerca de este artículo

Número CAS:
UNSPSC Code:
12352202
EC Number:
309-705-0
NACRES:
NA.61
MDL number:
Form:
essentially salt-free, lyophilized powder
Assay:
≥90% (SDS-PAGE)
Biological source:
equine heart

111,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicita un pedido personalizado
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle


biological source

equine heart

Quality Segment

assay

≥90% (SDS-PAGE)

form

essentially salt-free, lyophilized powder

Iron content

≥0.20%

technique(s)

MALDI-MS: suitable

UniProt accession no.

storage temp.

−20°C

Gene Information

horse ... MB(100054434)

Application

Myoglobin from equine heart is suitable for use in:
  • spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
  • the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
  • the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
  • a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
  • a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]

Biochem/physiol Actions

Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 1

Este artículo
M0630C7752C2506
technique(s)

MALDI-MS: suitable

technique(s)

mass spectrometry (MS): suitable

technique(s)

cell culture | mammalian: suitable

technique(s)

cell based assay: suitable

biological source

equine heart

biological source

equine skeletal muscle

biological source

horse heart

biological source

horse heart

assay

≥90% (SDS-PAGE)

assay

95-100%

assay

≥95% (SDS-PAGE), ≥95% based on Mol. Wt. 12,384 basis

assay

≥95% (SDS-PAGE)

form

essentially salt-free, lyophilized powder

form

essentially salt-free, lyophilized powder

form

powder

form

powder

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

UniProt accession no.

P68082

UniProt accession no.

P68082

UniProt accession no.

P00004

UniProt accession no.

P00004


Still not finding the right product?

Explore all of our products under Myoglobin from equine heart


Clase de almacenamiento

11 - Combustible Solids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, type N95 (US)



Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos



Preguntas

1–9 de 9 Preguntas  
  1. Do you have the sequence for Product M1882, Myoglobin from equine heart?

    1 respuesta
    1. This product has not been specifically sequenced. However, according to the Uniprot accession number P68082, equine myoglobin has the following sequence:

      MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG

      Please see the link below to review additional information available at UniProt:

      https://www.uniprot.org/uniprotkb/P68082/entry

      ¿Le ha resultado útil?

  2. I would like to consult you about the valence state of the ion in MB. Is it 2+ or 3+?

    1 respuesta
    1. This product is native myoglobin isolated from equine heart and is probably a mixture of oxidized myoglobin (metmyoglobin, Fe3+) and reduced myoglobin (Fe2+). The percentages of oxidized or reduced myoglobin in the product are not determined.

      ¿Le ha resultado útil?

  3. Was this product recombinantly expressed or was it isolated directly from the heart of the horse ?

    1 respuesta
    1. This product is native myoglobin isolated from equine heart.

      ¿Le ha resultado útil?

  4. Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?

    1 respuesta
    1. This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.

      ¿Le ha resultado útil?

  5. Is Product M1882, Myoglobin from equine heart, metmyoglobin?

    1 respuesta
    1. The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.

      ¿Le ha resultado útil?

  6. Is Product M1882, Myoglobin from equine heart, oxidized?

    1 respuesta
    1. Yes, it is oxidized.

      ¿Le ha resultado útil?

  7. Which has more affinity for oxygen, hemoglobin or myoglobin?

    1 respuesta
    1. The affinity of myoglobin for oxygen is higher than that of hemoglobin.

      ¿Le ha resultado útil?

  8. What is the Department of Transportation shipping information for this product?

    1 respuesta
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      ¿Le ha resultado útil?

  9. What is the molecular weight of Product M1882, Myoglobin from equine heart?

    1 respuesta
    1. Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.

      ¿Le ha resultado útil?

Revisiones

Filtros activos

  1. New York
    • Reseña 1
    • Votos 0
    4 de 5 estrellas.

    Is the myoglobin from equine heart dispersive in water?
    Or what are the solvent where it is dispersive.

    Traducir con Google

    ¿Le ha resultado útil?

    1. Respuesta de Merck KGaA:

      Thank you for your review. We encourage customers who experience problems with our products to call or email us for additional technical support. Please visit https://www.sigmaaldrich.com/US/en/support/customer-support to submit a Product Technical Inquiry.