HPA077713
Anti-Znf728 Antibody Produced In Rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
About This Item
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
formulario
buffered aqueous glycerol solution
purificado por
(Affinity purified using the PrEST antigen as affinity ligand)
reactividad de especies
human
concentración
0.2mg/ml
técnicas
immunofluorescence: 0.25-2 μg/mL
isotipo
IgG
nota de secuencia
HELVKEPPGRTGHELWLRKLELSLGTAIGTKVCRPASIALNGYHSPGLWKTQDLSQTVAGRSLG
Ensembl | nº de acceso humano
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
-10 to -25°C
Información sobre el gen
human ... ZNF728(388523)
Descripción general
Inmunógeno
Aplicación
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies™ protocols and other useful information.
Características y beneficios
Ligadura / enlace
Forma física
Otras notas
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Información legal
Cláusula de descargo de responsabilidad
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico