HPA051870
Anti-TMEM119 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Tmem119 Antibody, Tmem119 Antibody - Anti-TMEM119 antibody produced in rabbit, Anti-transmembrane protein 119
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
formulario
buffered aqueous glycerol solution
reactividad de especies
human
validación mejorada
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnicas
immunohistochemistry: 1:500-1:1000
secuencia del inmunógeno
GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... TMEM119(338773)
Descripción general
Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3. The encoded protein belongs to the transmembrane protein family. TMEM119 has an O-glycosylated N-terminal region.
Inmunógeno
transmembrane protein 119 recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-TMEM119 antibody produced in rabbit has been used in immunohistochemistry.
Acciones bioquímicas o fisiológicas
Transmembrane protein 119 (TMEM119) acts as an osteoinductive factor and facilitates proliferation, migration and invasion of osteosarcoma cells.(28} It is a critical molecule acting downstream of the parathyroid hormone (PTH) and similar to mothers against decapentaplegic-3 (Smad3) signaling pathways in osteoblasts. TMEM119 is considered to be a potential microglial marker that differentiates resident microglia from blood-derived macrophages in the human brain. Mutation in the gene is associated with the development of osteosarcoma.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST85802
Forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Tobias Zrzavy et al.
Brain : a journal of neurology, 140(7), 1900-1913 (2017-05-26)
Microglia and macrophages accumulate at the sites of active demyelination and neurodegeneration in the multiple sclerosis brain and are thought to play a central role in the disease process. We used recently described markers to characterize the origin and functional
Upregulation and biological function of transmembrane protein 119 in osteosarcoma.
Jiang Z H, et al.
Experimental & Molecular Medicine, 49(5), e329-e329 (2017)
Parathyroid hormone-responsive Smad3-related factor, Tmem119, promotes osteoblast differentiation and interacts with the bone morphogenetic protein-Runx2 pathway.
Hisa I, et al.
The Journal of Biological Chemistry, 286(11), 9787-9796 (2011)
Zhen-Huan Jiang et al.
Experimental & molecular medicine, 49(5), e329-e329 (2017-05-13)
Osteosarcoma is suggested to be caused by genetic and molecular alterations that disrupt osteoblast differentiation. Recent studies have reported that transmembrane protein 119 (TMEM119) contributes to osteoblast differentiation and bone development. However, the level of TMEM119 expression and its roles
Tobias Zrzavy et al.
Brain pathology (Zurich, Switzerland), 28(6), 791-805 (2017-12-10)
Inflammatory mechanisms, involving granulocytes, T-cells, B-cells, macrophages and activated microglia, have been suggested to play a pathogenic role in experimental models of stroke and may be targets for therapeutic intervention. However, knowledge on the inflammatory response in human stroke lesions
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico