HPA042727

Anti-SLC10A1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-NTCP, Anti-Solute Carrier Family 10 (Sodium/Bile Acid Cotransporter Family), Member 1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA042727

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunoblotting: 0.4 μg/mL; immunohistochemistry: 1:1000- 1:2500
• secuencia del inmunógeno: CYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGE
• Nº de acceso UniProt: Q14973
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC10A1(6554)

Descripción

Descripción general

The gene SLC10A1 (solute carrier family 10 member 1) is mapped to human chromosome 14q24.2. It is mainly expressed in the liver cells.
SLC10A1 protein interacts with:
C11ORF74 (anti-C11ORF74 HPA044880)

Inmunógeno

solute carrier family 10 (sodium/bile acid cotransporter family), member 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-SLC10A1 antibody produced in rabbit has been used in immunohistochemistry and western blotting.

Acciones bioquímicas o fisiológicas

SLC10A1 (solute carrier family 10 member 1) is a bile acid transporter. It plays an important role in the circulation of bile acids. Mutation in this gene is associated with hypercholanemia. SLC10A1 also plays an important role in the entry of HBV (Hepatitis B virus) and silencing of this gene inhibits HBV infection. It works as a receptor for preS1 domain in HBV.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST83919

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable