Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

HPA036561

Sigma-Aldrich

Anti-SCLT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-FLJ30655, Anti-HCAP-1A, Anti-Sodium channel and clathrin linker 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

secuencia del inmunógeno

KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SCLT1(132320)

Descripción general

Sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) is an important protein that has distinct domains. It is expressed in DRG (dorsal root ganglion) neurons. SCLT1 gene is located on human chromosome 4q28.2.

Inmunógeno

sodium channel and clathrin linker 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SCLT1 antibody has been used in immunostaining and indirect immunofluorescence.

Acciones bioquímicas o fisiológicas

The domains of sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) has the ability to bind and form a multiprotein complex with Na(v)1.8 and clathrin. Lack of SCLT1 results in cystic kidney. It induces membrane docking and is essential for ciliogenesis.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST79787

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Confirmation that mutations in DDX59 cause an autosomal recessive form of oral-facial-digital syndrome: Further delineation of the DDX59 phenotype in two new families.
Faily S, et al.
European Journal of Medical Genetics, 60(10), 527-532 (2017)
Satoshi Katagiri et al.
Scientific reports, 8(1), 16733-16733 (2018-11-15)
Senior Løken syndrome (SLS) is a heterogeneous disorder characterized by severe retinal degenerations and juvenile-onset nephronophthisis. Genetic variants in ten different genes have been reported as the causes of SLS. Clinical evaluation of a patient with SLS and her unaffected
Sclt1 deficiency causes cystic kidney by activating ERK and STAT3 signaling.
Li J, et al.
Human Molecular Genetics, 26(15), 2949-2960 (2017)
Analysis of LRRC45 indicates cooperative functions of distal appendages at early steps of ciliogenesis.
Kurtulmus B, et al.
bioRxiv, 205625-205625 (2017)
CAP-1A is a novel linker that binds clathrin and the voltage-gated sodium channel Nav1. 8
Liu C, et al.
Molecular and Cellular Neurosciences, 28(4), 636-649 (2005)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico