HPA024662

Anti-TSPOAP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinónimos: Anti-BZRAP1, Anti-KIAA0612, Anti-PRAX-1, Anti-RIM-BP1, Anti-RIMBP1, Anti-PBR-IP, Anti-Peripheral benzodiazepine receptor-interacting protein, Anti-Peripheral-type benzodiazepine receptor-associated protein 1, Anti-RIMS-binding protein 1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA024662
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: independent; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:200- 1:500
• secuencia del inmunógeno: DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTPPAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAEACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNMSFGD
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... BZRAP1(9256)

Descripción

Descripción general

The gene BZRAP1 (benzodiazepine receptor (peripheral) associated protein 1) is mapped to human chromosome 17q22-q23. The mRNA is mainly expressed in the central nervous system, pituitary gland and thymus. The protein is mainly expressed in the brain and thymus. The protein is present in the cytoplasm and mitochondria, and has three proline-rich domains, three leucine-zipper motifs and an Src homology region 3-like domain.

Inmunógeno

TSPO associated protein 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

BZRAP1 (benzodiazepine receptor associated protein 1, also referred to as RIM-BP1 (RIMS-binding protein 1)) interacts with peripheral benzodiazepine receptor (PBR). It also interacts with the presynaptic active zone proteins RIMs (Rab-3 interacting molecules) and voltage-gated Ca²⁺-channels. RIM-BPs help in maintaining a functional connection between Ca²⁺-channels and the synaptic-vesicle tethering apparatus.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST75567

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable