HPA020103
Anti-MACC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
Sinónimos:
Anti-SH3 domain-containing protein 7a5
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
formulario
buffered aqueous glycerol solution
reactividad de especies
human
técnicas
immunohistochemistry: 1:50- 1:200
secuencia del inmunógeno
FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
Nº de acceso UniProt
aplicaciones
research pathology
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... MACC1(346389)
Descripción general
Metastasis associated in colon cancer 1 (MACC1) is an 852 amino acid protein with a Src-homology 3 (SH3)-domain and a motif which is rich in proline. The gene encoding it has been studied as an oncogene in a wide variety of carcinomas like that of the lung and liver. It is localized on human chromosome 7.
Inmunógeno
SH3 domain-containing protein 7a5 recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-MACC1 antibody produced in rabbit has been used in immunohistochemistry and immunoblotting.
Anti-MACC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Acciones bioquímicas o fisiológicas
Metastasis associated in colon cancer 1 (MACC1) functions as a regulator in the mitogen-activated protein kinase (MAPK) pathways in breast carcinoma. It is also involved in the pathways mediated by hepatocyte growth factor (HGF). MACC1 is associated with metastasis of colon cancer and it is useful as a biomarker for progression of many cancers, like gastric cancer.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST75105
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
MACC1 is post-transcriptionally regulated by miR-218 in colorectal cancer
Ilm K, et al.
Oncotarget, 7(33), 53443-53443 (2016)
Ga-Eon Kim et al.
Analytical and quantitative cytopathology and histopathology, 37(2), 96-104 (2015-06-13)
To investigate whether metastasis associated in colon cancer 1 (MACC1) expression is a prognostic marker in breast cancer and to demonstrate the potential correlation between MACC1 and mitogen-activated protein kinase (MAPK) expression. Immunohistochemical staining with anti-MACC1 and phospho-p44/42 MAPK antibodies
Hassan Ashktorab et al.
Journal of translational medicine, 14(1), 215-215 (2016-07-22)
Colorectal cancer is a preventable disease if caught at early stages. This disease is highly aggressive and has a higher incidence in African Americans. Several biomarkers and mutations of aggressive tumor behavior have been defined such as metastasis-associated in colon
MACC1 regulates Fas mediated apoptosis through STAT1/3--Mcl-1 signaling in solid cancers
Radhakrishnan H, et al.
Cancer Letters, 403(33), 231-245 (2017)
Lijian Chen et al.
Journal of cancer research and therapeutics, 10(4), 1052-1056 (2015-01-13)
The clinical significance of metastasis associated in colon cancer 1 (MACC1), in human gallbladder cancer, is not yet established. This study was performed to assess the expression of MACC1 in benign and malignant gallbladder lesions, and to assess its clinicopathological
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico