Saltar al contenido
Merck
Todas las fotos(6)

Documentos clave

HPA014765

Sigma-Aldrich

Anti-ITPR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-ACV, Anti-IP3R1, Anti-Insp3r1, Anti-PPP1R94, Anti-SCA15, Anti-SCA16, Anti-SCA29

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

secuencia del inmunógeno

KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ITPR1(3708)

Descripción general

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a ligand-gated calcium channel, which is present in the endoplasmic reticulum (ER). It either acts as a homotetarmer or forms heterotetramer with type 2 or type 3 inositol 1,4,5-trisphosphate receptors. It is highly expressed in the central nervous system, especially in the Purkinje cells of the cerebellum. This channel contains a coupling/regulatory domain, which consists of phosphorylation sites, a proteolytic cleavage region, ATP-binding sites, and binding sites for multiple proteins. This gene is localized to human chromosome 3p26.

Inmunógeno

Inositol 1,4,5-trisphosphate receptor type 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a Ca2+-channel, which is activated upon binding by inositol 1,4,5-trisphosphate (IP3), and releases Ca2+ from endoplasmic reticulum (ER) into the cytoplasm. This released calcium participates in various Ca2+-dependent signaling and cellular processes. It is activated on death receptor binding or cellular damage, and regulates intracellular calcium levels during apoptosis. Heterozygous deletion in this gene is responsible for the autosomal dominant neurodegenerative disorder spinocerebellar ataxia type 15 (SCA15), which is characterized by late-onset, slow-progressive cerebellar ataxia. It is involved in the activation of T-cells, where it gets phosphorylated at Y353 residue, located at the IP3-binding domain. It plays an essential role in the initial stages of myoblast differentiation, where it induces the expression of myogenin and MEF2 (myocyte enhancer factor 2), which are transcription factors specific to muscles. ITPR1 is also essential for development and maintenance of cerebellum.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73267

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Masato Obayashi et al.
Journal of human genetics, 57(3), 202-206 (2012-02-10)
Spinocerebellar ataxia type 15 (SCA15) is an autosomal dominant neurodegenerative disorder clinically characterized by late-onset, slowly progressive pure cerebellar ataxia. This disease is caused by a heterozygous deletion of the inositol 1, 4, 5-triphosphate receptor type 1 (ITPR1) gene, suggesting
Fabrice Antigny et al.
Cell calcium, 56(6), 513-521 (2014-12-04)
Cytosolic Ca(2+) signals are fundamental for the early and late steps of myoblast differentiation and are, as in many cells, generated by Ca(2+) release from internal stores as well as by plasma membrane Ca(2+) entry. Our recent studies identified the
Margaret P Adam et al.
GeneReviews(?), 2006 May 30 (Updated 2014 Jun 12) (2014-06-12)
Spinocerebellar ataxia type 15 (SCA15) is characterized by slowly progressive gait and limb ataxia, often in combination with ataxic dysarthria, titubation, upper limb postural tremor, mild hyperreflexia, gaze-evoked nystagmus, and impaired vestibuloocular reflex gain. Onset is between ages seven and
Lijia Huang et al.
Orphanet journal of rare diseases, 7, 67-67 (2012-09-19)
Congenital nonprogressive spinocerebellar ataxia is characterized by early gross motor delay, hypotonia, gait ataxia, mild dysarthria and dysmetria. The clinical presentation remains fairly stable and may be associated with cerebellar atrophy. To date, only a few families with autosomal dominant
Nikhil deSouza et al.
The Journal of cell biology, 179(5), 923-934 (2007-12-07)
Sustained elevation of intracellular calcium by Ca2+ release-activated Ca2+ channels is required for lymphocyte activation. Sustained Ca2+ entry requires endoplasmic reticulum (ER) Ca2+ depletion and prolonged activation of inositol 1,4,5-trisphosphate receptor (IP(3)R)/Ca2+ release channels. However, a major isoform in lymphocyte

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico