HPA012750

Anti-HLA-DMA antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-AL662845.5, Anti-HLA class II histocompatibility antigen, DM alpha chain precursor, Anti-MHC class II antigen DMA
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA012750
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: PTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEV
• Nº de acceso UniProt: P28067
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HLA-DMA(3108)

Descripción

Descripción general

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is a membrane-anchored heterodimeric protein that belongs to the family of proteins with a major histocompatibility (MHC) fold. It contains a peptide-binding site which is altered to an almost fully closed groove-like structure.

Inmunógeno

HLA class II histocompatibility antigen, DM alpha chain precursor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-HLA-DMA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is majorly involved in antigen presentation to cluster of differentiation-4 (CD4) T-cells. It catalyzes the release of class II-associated invariant chain-derived peptides (CLIP) from class II histocompatibility molecules which are newly synthesized. It has a peptide exchange activity and functions as a chaperone to peptide-free class II major histocompatibility (MHC) molecules. HLA-DMA binds to class II molecules, like HLA-DR for catalysis and the inhibitor HLA-DO.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71880

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)