Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

HPA011126

Sigma-Aldrich

Anti-BTN1A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-BT, Anti-Butyrophilin subfamily 1 member A1 precursor

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

secuencia del inmunógeno

DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... BTN1A1(696)

Descripción general

BTN1A1 (butyrophilin, subfamily 1, member A1) belongs to the BTN gene family, which resides within the major histocompatibility complex class I region on gene 6p22.1. This protein is composed of 526 amino acids and has a hydrophobic signal sequence at its N-terminal, which is made of 26 amino acids. The signal peptide is cleaved off before the secretion of the protein. BTN1A1 also belongs to immunoglobulin (Ig) superfamily, where the Ig domains are present in the extracellular region. The protein has a transmembrane region and short heptad repeats in the cytoplasmic tail. It is predominantly expressed in the epithelium of lactating mammary gland.

Inmunógeno

Butyrophilin subfamily 1 member A1 precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

BTN1A1 (butyrophilin, subfamily 1, member A1) is a milk protein which is secreted in milk in the lipid droplets. It controls the secretion of lipid droplets in milk, by interacting with xanthine dehydrogenase/oxidase, and acting either as a receptor or structural protein. Inactivation of this gene in mice leads to the formation of triacylglycerol pools in the cytoplasm. When present in dietary products, BTN1A1 leads to alterations in multiple sclerosis (MS). This is because of the similarity in the IgI domain of BTN1A1 and the IgV domain of myelin oligodendrocyte glycoprotein (MOG). MOG is the antigen for auto-antibodies, and is found on the myelin nerve sheath of MS patients.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71881

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sherry L Ogg et al.
Proceedings of the National Academy of Sciences of the United States of America, 101(27), 10084-10089 (2004-07-01)
Butyrophilin 1a1 (Btn1a1), which is a member of the Ig superfamily, is highly expressed in the lactating mammary gland and is secreted into milk in association with lipid droplets. To determine the potential function of Btn1a1 in milk secretion, we
D A Rhodes et al.
Genomics, 71(3), 351-362 (2001-02-15)
We sequenced the 170-kb cluster of BTN genes in the extended major histocompatibility complex region, 4 Mb telomeric of human leukocyte antigen class I genes, at 6p22.1. The cluster consists of seven genes belonging to the expanding B7/butyrophilin-like group, a
Jaekwang Jeong et al.
The Journal of biological chemistry, 284(33), 22444-22456 (2009-06-18)
Butyrophilin 1A1 (BTN1A1) and xanthine oxidoreductase (XOR) are highly expressed in the lactating mammary gland and are secreted into milk associated with the milk fat globule membrane (MFGM). Ablation of the genes encoding either protein causes severe defects in the
I H Mather et al.
Journal of dairy science, 76(12), 3832-3850 (1993-12-01)
The molecular and cellular biology of the milk protein butyrophilin is reviewed. Butyrophilin constitutes more than 40% by weight of the total protein associated with the fat globule membrane of bovine milk. Closely related proteins are abundant in the fat

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico