HPA010689

Anti-PTGER3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-PGE receptor, EP3 subtype, Anti-PGE2-R, Anti-Prostaglandin E2 receptor EP3 subtype, Anti-Prostanoid EP3 receptor
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA010689
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:50- 1:200
• secuencia del inmunógeno: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
• Nº de acceso UniProt: P43115
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PTGER3(5733)

Descripción

Descripción general

PTGER3 (prostaglandin E receptor 3) gene encodes a seven-transmembrane-spanning protein with multiple C-terminal tails. The gene is mapped to human chromosome 1p31.2 and consists of 10 exons interspaced by nine introns. The TM domain and the 10 amino acid residues of the cytoplasmic tail are encoded by exon1 and 5′ 180-bp portion of exon 2.

Inmunógeno

Prostaglandin E2 receptor EP3 subtype recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-PTGER3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Acciones bioquímicas o fisiológicas

PTGER3 (prostaglandin E receptor 3) gene encodes a G-protein coupled receptor that functions as a receptor for prostaglandin E₂ (PGE2). It induces smooth-muscle contractility. It is moderately expressed in smooth muscle cells of the proximal, mid and distal ureter. It functions via cAMP response elements (CRE) and serves as a target for anti-inflammatory therapy in cutaneous inflammation. This receptor is mainly localized in primary sensory neurons and the spinal cord and functions in endogenous pain control. It has been found to be expressed in the joint nerves of patients with painful osteoarthritis. It plays a role in mediating antinociception during inflammation. It mediates contraction of human intercostal arteries by prostaglandin E₂.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72461

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)