HPA007888

Anti-CECR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Cat eye syndrome critical region protein 1 precursor antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA007888
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CECR1(51816)

Descripción

Descripción general

CECR1 (cat eye syndrome chromosome region, candidate 1) gene encodes a member of the family of adenosine deaminase growth factors (ADGFs) that have sequence similarity with classical adenosine deaminase (ADA) at the C-terminus. CECR1 is mainly expressed in fetal heart and kidney and in adult heart, lung and kidney. It contains an ADA (adenosine deaminase) domain and functions by regulating the level of extra-cellular adenosine. It is extensively glycosylated and contains a conserved disulfide bond and a signal peptide. This gene is mapped to human chromosome 22q11.2.

Inmunógeno

Cat eye syndrome critical region protein 1 precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

CECR1 (cat eye syndrome chromosome region, candidate 1) is also called as ADA2 (adenosine deaminase 2) and plays a role in the degradation of extracellular adenosine, which acts as a signaling molecule in several cellular processes. ADA2 is secreted by differentiating monocytes and may function in the regulation of cell proliferation and differentiation. It is bound to the cell surface via proteoglycans and certain adenosine deaminase receptors. It promotes T cell-dependent differentiation of monocytes into macrophages and promotes proliferation of macrophages. It may serve as a drug candidate to regulate the immune responses during inflammation and cancer. Defects in this gene are associated with Cat eye syndrome and is responsible for some of the phenotype observed in this syndrome.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73541

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)