HPA003179

Anti-MED15 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-ARC105, Anti-Activator-recruited cofactor 105 kDa component antibody produced in rabbit, Anti-CTG repeat protein 7a, Anti-PC2 glutamine/Q-rich-associated protein, Anti-PCQAP, Anti-Positive cofactor 2 glutamine/Q-rich-associated protein antibody produced in rabbit, Anti-TIG-1, Anti-TPA-inducible gene 1 protein, AntiMediator complex subunit 15
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA003179
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• secuencia del inmunógeno: QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
• Nº de acceso UniProt: Q96RN5
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MED15(51586)

Descripción

Descripción general

The gene MED15 (mediator complex subunit 15) is mapped to human chromosome 22q11.2, a region found to be deleted in DiGeorge syndrome.

Inmunógeno

Mediator of RNA polymerase II transcription subunit 15 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-MED15 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Acciones bioquímicas o fisiológicas

MED15 (mediator complex subunit 15) gene encodes a component of the multiprotein complex ARC/Mediator complex and functions as a transcriptional coactivator in RNA polymerase II transcription. It links TGF β/Activin/Nodal/Smad2/3 signaling to transcriptional activation. The sterol regulatory element binding protein (SREBP) binds to MED15 and mediates regulation and control of cholesterol and lipid homeostasis. The mediator complex plays an important role in eukaryotic gene transcription. Aberrations in the genes encoding the subunits of this complex have been associated with cardiovascular diseases.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73543

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)