Saltar al contenido
Merck

C8490

SAFC

CRG-2 from mouse

BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture

Sinónimos:

CXCL10, Cytokine Responsive Gene 2, IP-10

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352209
NACRES:
NA.75

recombinante

expressed in E. coli

Nivel de calidad

Línea del producto

BioReagent

Análisis

≥97% (SDS-PAGE)

formulario

lyophilized powder

mol peso

predicted mol wt ~8.8 kDa

técnicas

cell culture | mammalian: suitable

impurezas

endotoxin, tested

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Información sobre el gen

mouse ... Cxcl10(15945)

Descripción general

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.

Forma física

Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine

Nota de análisis

The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, type N95 (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

S Mahalingam et al.
Immunology and cell biology, 78(2), 156-160 (2000-04-13)
MuMig (monokine induced by gamma interferon) and Crg-2 (cytokine responsive gene) are chemokines of the CXC subfamily. They share activity as T and NK cell chemoattractants. Crg-2 has been shown to be inducible by IFN, TNF, IL-1 and LPS, whereas
Y Ohmori et al.
Biochemical and biophysical research communications, 168(3), 1261-1267 (1990-05-16)
Recently, we have isolated and characterized a set of cDNA clones which encode lipopolysaccharide-inducible proteins in murine peritoneal macrophages. Here, we report the sequence and identification of one of these cDNAs previously termed C7. Nucleotide sequence analysis revealed an open
Takanobu Utsumi et al.
The Journal of urology, 192(2), 567-574 (2014-02-13)
Renal cell carcinoma expresses CXCR3 but the function of CXCR3 in renal cell carcinoma has not been clarified. We explored the function of CXCR3 in renal cell carcinoma and investigated CXCR3 regulating factors. We obtained 56 clinical samples of clear cell
P Vanguri et al.
The Journal of biological chemistry, 265(25), 15049-15057 (1990-09-05)
In order to identify novel proteins produced by activated macrophages, a cDNA library was made from cultures of the mouse macrophage-like cell line RAW 264.7 that had been treated with conditioned medium from mitogen-stimulated spleen cells, and the library was
Yingping Hou et al.
The Journal of investigative dermatology, 135(12), 3060-3067 (2015-07-24)
Recessive dystrophic epidermolysis bullosa (RDEB) is an inherited disorder characterized by skin fragility, blistering, and multiple skin wounds with no currently approved or consistently effective treatment. It is due to mutations in the gene encoding type VII collagen (C7). Using

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico