Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV54369

Sigma-Aldrich

Anti-NKIRAS2 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DKFZP434N1526, Anti-KBRAS2, Anti-KappaB-Ras2, Anti-MGC74742, Anti-NFKB inhibitor interacting Ras-like 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

21 kDa

reactividad de especies

rabbit, bovine, mouse, horse, pig, human, rat, dog

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... NKIRAS2(28511)

Inmunógeno

Synthetic peptide directed towards the middle region of human NKIRAS2

Aplicación

Anti-NKIRAS2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

NKIRAS2 (NFKB inhibitor interacting Ras-like 2) encodes a protein that belongs to Ras family and κB-Ras subfamily. NKIRAS2 interacts with PEST domains of IκBα and IκBβ [inhibitors of the transcription factor nuclear factor κ B (NF-κB)] and decreases their rate of degradation.

Secuencia

Synthetic peptide located within the following region: KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

C Fenwick et al.
Science (New York, N.Y.), 287(5454), 869-873 (2000-02-05)
Small guanosine triphosphatases, typified by the mammalian Ras proteins, play major roles in the regulation of numerous cellular pathways. A subclass of evolutionarily conserved Ras-like proteins was identified, members of which differ from other Ras proteins in containing amino acids

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico