Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV51642

Sigma-Aldrich

Anti-PAXIP1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-CAGF28, Anti-CAGF29, Anti-FLJ41049, Anti-PACIP1, Anti-PAX interacting (with transcription-activation domain) protein 1, Anti-PAXIP1L, Anti-PTIP, Anti-TNRC2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

74 kDa

reactividad de especies

rat, guinea pig, rabbit, horse, human, dog, bovine, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_031375

Nº de acceso UniProt

Q6ZW49

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PAXIP1(22976)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PAXIP1

Aplicación

Anti-PAXIP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Acciones bioquímicas o fisiológicas

PAX interacting (with transcription-activation domain) protein 1 (PAXIP1) is a nuclear protein that belongs to the paired box gene family. It is characterized by six breast cancer carboxy-terminal (BRCT) domains. PAXIP1 is involved in chromatin condensation during mitosis and maintenance of genome stability.

Secuencia

Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ivan M Munoz et al.
Nucleic acids research, 35(16), 5312-5322 (2007-08-11)
Human (h)PTIP plays important but poorly understood roles in cellular responses to DNA damage. hPTIP interacts with 53BP1 tumour suppressor but only when 53BP1 is phosphorylated by ATM after DNA damage although the mechanism(s) and significance of the interaction of
Eun Ah Cho et al.
Molecular and cellular biology, 23(5), 1666-1673 (2003-02-18)
The Pax transactivation domain-interacting protein (PTIP) is a large nuclear protein with multiple BRCT domains that was identified on the basis of its interaction with transcription factors of the Pax and Smad families. To address the function of PTIP during

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico