Saltar al contenido
Merck
Todas las fotos(2)

Documentos

AV51319

Sigma-Aldrich

Anti-GP1BA antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-BSS, Anti-CD42B, Anti-CD42b-α+F12935, Anti-GP1B, Anti-Glycoprotein Ib (platelet), α polypeptide, Anti-MGC34595

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

68 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_000164

Nº de acceso UniProt

P07359

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... GP1BA(2811)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human GP1BA

Aplicación

Anti-GP1BA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Acciones bioquímicas o fisiológicas

Glycoprotein Ib (GP1BA) is a membrane glycoprotein present on the surface of platelets. It acts as the receptors for von Willebrand factor that facilitates the adhesion of platelets to vascular subendothelium after vascular injury, thrombosis, platelet activation and hemostasis. Mutations in GP1BA are associated with Bernard-Soulier syndromes and platelet-type von Willebrand disease.

Secuencia

Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sayer I Al-Azzam et al.
Gene, 526(2), 118-121 (2013-05-22)
Aspirin is an antiplatelet agent commonly used in treatment of patients with high risk to develop stroke and myocardial infarction. However, inter-individual variability regarding the inhibition of platelet function by aspirin is well documented. In this study, the correlation between
Maha Othman et al.
Seminars in thrombosis and hemostasis, 39(6), 663-673 (2013-08-13)
Compared with coagulation factor defects, little attention is given to defects of platelet function as causes of rare bleeding disorders. Platelet-type von Willebrand disease (PT-VWD) is an autosomal dominant bleeding disorder and is unique among platelet disorders because it is
Naomasa Yamamoto et al.
Thrombosis research, 131(4), e160-e167 (2013-02-19)
A defective platelet glycoprotein (GP) Ib/IX/V complex [von Willebrand factor (VWF) receptor] results in Bernard-Soulier syndrome (BSS), which is characterized by macrothrombocytopenia and impaired ristocetin- and thrombin-induced platelet aggregation. We found 2 independent BSS-variant families: Case I [compound heterozygous mutations

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico