Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV50276

Sigma-Aldrich

Anti-ASB5 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Ankyrin repeat and SOCS box-containing 5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

36 kDa

reactividad de especies

rabbit, mouse, rat, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_543150

Nº de acceso UniProt

Q8WWX0

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ASB5(140458)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ASB5

Aplicación

Anti-ASB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Ankyrin repeat and SOCS box containing 5 (ASB5) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins. These proteins regulate protein turnover by targeting proteins for polyubiquitination and proteasome-mediated degradation. It is expressed in endothelial cells and smooth muscle cells and is involved in arteriogenesis.

Secuencia

Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Benjamin T Kile et al.
Trends in biochemical sciences, 27(5), 235-241 (2002-06-22)
Although initially identified in the suppressor of cytokine signaling (SOCS) family of proteins, the C-terminal SOCS box has now been identified in more than 40 proteins in nine different families. Growing evidence suggests that the SOCS box, similar to the
Kerstin Boengler et al.
Biochemical and biophysical research communications, 302(1), 17-22 (2003-02-21)
Arteriogenesis, the growth of pre-existing collateral arteries, can be induced in rabbit by occlusion of the femoral artery. In order to identify and characterize genes differentially expressed during the early phase of arteriogenesis, cDNA of collateral arteries 24h after femoral

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico