Saltar al contenido
Merck
Todas las fotos(2)

Documentos

AV50240

Sigma-Aldrich

Anti-MOGAT1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DGAT2L, Anti-DGAT2L1, Anti-MGAT1, Anti-Monoacylglycerol O-acyltransferase 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Número MDL:
MFCD02262953
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

39 kDa

reactividad de especies

mouse, pig, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_477513

Nº de acceso UniProt

Q96PD6

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... MOGAT1(116255)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the C terminal region of human MOGAT1

Aplicación

Anti-MOGAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Monoacylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the synthesis of diacylglycerols that in turn act as precursors for the triacylglycerols and phospholipids. MOGAT enzymes are highly expressed in the liver; hepatic MOGAT1 is a potential therapeutic target for metabolic disorders such as obesity, steatosis and type 2 diabetes mellitus.

Secuencia

Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Angela M Hall et al.
Journal of lipid research, 53(5), 990-999 (2012-03-08)
Intrahepatic lipid accumulation is extremely common in obese subjects and is associated with the development of insulin resistance and diabetes. Hepatic diacylglycerol and triacylglycerol synthesis predominantly occurs through acylation of glycerol-3-phosphate. However, an alternative pathway for synthesizing diacylglycerol from monoacylglycerol
Yasuhiro Hayashi et al.
Molecular therapy. Nucleic acids, 3, e154-e154 (2014-03-20)
Over the past decade, considerable advances have been made in the discovery of gene targets in metabolic diseases. However, in vivo studies based on molecular biological technologies such as the generation of knockout mice and the construction of short hairpin

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico