AV50121
Anti-JAM3 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-Junctional adhesion molecule 3
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
28 kDa
reactividad de especies
human, guinea pig, mouse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... JAM3(83700)
Categorías relacionadas
Descripción general
The gene Junctional adhesion molecule 3 (JAM3; JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains. It belongs to Ig-superfamily called as JAMs. JAM3 is widely expressed with predominant expression in placenta, brain and kidney. It is also expressed in platelets but not in other blood cells.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human JAM3
Aplicación
Anti-JAM3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
Junctional adhesion molecule 3 (JAM3; JAM-C) is a protein localized at the tight junctions of endothelial cells and acts as a receptor for another JAM molecule. JAM3 is involved in the regulation of vascular permeability, angiogenesis and nerve function. Deficient expression of JAM3 results in severe hydrocephalus and development of tumors in murine models. JAM3 is involved in lymphangiogenesis and nodal metastasis in non-small cell lung cancer. It is also associated with melanoma cell metastasis.
Secuencia
Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
David A Leinster et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(10), 4244-4253 (2013-07-05)
Junctional adhesion molecule C (JAM-C) is a transmembrane protein with significant roles in regulation of endothelial cell (EC) functions, including immune cell recruitment and angiogenesis. As these responses are important in promoting tumor growth, the role of EC JAM-C in
Harald F Langer et al.
Cancer research, 71(12), 4096-4105 (2011-05-20)
Hematogenous dissemination of melanoma is a life-threatening complication of this malignant tumor. Here, we identified junctional adhesion molecule-C (JAM-C) as a novel player in melanoma metastasis to the lung. JAM-C expression was identified in human and murine melanoma cell lines
Lena Wyss et al.
PloS one, 7(9), e45619-e45619 (2012-10-03)
The junctional adhesion molecule (JAM)-C is a widely expressed adhesion molecule regulating cell adhesion, cell polarity and inflammation. JAM-C expression and function in the central nervous system (CNS) has been poorly characterized to date. Here we show that JAM-C(-/-) mice
Sentot Santoso et al.
The Journal of experimental medicine, 196(5), 679-691 (2002-09-05)
The recently described junctional adhesion molecules (JAMs) in man and mice are involved in homotypic and heterotypic intercellular interactions. Here, a third member of this family, human JAM-3, was identified and described as a novel counterreceptor on platelets for the
Christoph Scheiermann et al.
Science (New York, N.Y.), 318(5855), 1472-1475 (2007-12-01)
JAM-C is an adhesion molecule that is expressed on cells within the vascular compartment and epithelial cells and, to date, has been largely studied in the context of inflammatory events. Using immunolabeling procedures in conjunction with confocal and electron microscopy
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico