Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV49979

Sigma-Aldrich

Anti-UNC93B1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-MGC126617, Anti-UNC93, Anti-UNC93B, Anti-Unc-93 homolog B1 (C. elegans)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

67 kDa

reactividad de especies

bovine, horse, mouse, guinea pig, human, dog, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_112192

Nº de acceso UniProt

Q9H1C4

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... UNC93B1(81622)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human UNC93B1

Aplicación

Anti-UNC93B1 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Acciones bioquímicas o fisiológicas

Unc-93 homolog B1 (UNC93B1) is a transmembrane protein localized to the plasma membrane. It is involved in the trafficking of nucleic acid-sensing toll-like receptors (TLR) from endoplasmic reticulum to the endolysosomes. It regulates both innate and adaptive immune responses by regulating TLR signaling.

Secuencia

Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Bettina L Lee et al.
eLife, 2, e00291-e00291 (2013-02-22)
UNC93B1, a multipass transmembrane protein required for TLR3, TLR7, TLR9, TLR11, TLR12, and TLR13 function, controls trafficking of TLRs from the endoplasmic reticulum (ER) to endolysosomes. The mechanisms by which UNC93B1 mediates these regulatory effects remain unclear. Here, we demonstrate
Bruno Luiz Fonseca Schamber-Reis et al.
The Journal of biological chemistry, 288(10), 7127-7136 (2013-01-18)
The mammalian homolog B1 of Unc-93 Caenorhabditis elegans known as UNC93B1 is a chaperone protein that mediates translocation of the nucleic acid-sensing Toll-like receptors (TLRs) from the endoplasmic reticulum to the endolysosomes. The triple deficient (UNC93B1 mutant) mice have a
Jelka Pohar et al.
PloS one, 9(3), e92391-e92391 (2014-03-22)
Toll-like receptor 3 (TLR3) is a dsRNA sensing receptor that is localized in the cellular compartments but also at the plasma membrane. Overexpression of UNC93B1 promoted localization of TLR3, but not other nucleic acid sensing TLRs, to the plasma membrane.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico