AV48984

Anti-PCMTD1 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-FLJ10883, Anti-Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 41 kDa
• reactividad de especies: mouse, guinea pig, rat, bovine, dog, human, rabbit, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_443169
• Nº de acceso UniProt: Q96MG8
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... PCMTD1(115294)

Descripción

Descripción general

Mutations in Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 (PCMTD1) gene are associated with primary angle closure glaucoma (PACG).

Inmunógeno

Synthetic peptide directed towards the middle region of human PCMTD1

Aplicación

Anti-PCMTD1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Secuencia

Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable