AV48793

Anti-POLK antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DINB1, Anti-DINP, Anti-POLQ, Anti-Polymerase (DNA directed) kappa
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 99 kDa
• reactividad de especies: mouse, rat, dog, pig, bovine, horse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_057302
• Nº de acceso UniProt: Q9UBT6
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... POLK(51426)

Descripción

Descripción general

POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.

Inmunógeno

Synthetic peptide directed towards the middle region of human POLK

Aplicación

Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.

Secuencia

Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable