AV48481

Anti-OXCT1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-3-Oxoacid CoA transferase 1, Anti-OXCT, Anti-SCOT
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 52 kDa
• reactividad de especies: yeast, guinea pig, rat, bovine, human, mouse, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_000427
• Nº de acceso UniProt: P55809
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... OXCT1(5019)

Descripción

Descripción general

3-Oxoacid CoA transferase 1 (OCT1) is a mitochondrial enzyme that catalyzes the transfer of coenzyme A from succinyl-CoA to acetoacetate during ketone body catabolism. Mutations in OXCT1 have been linked to Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
Rabbit Anti-OXCT1 antibody recognizes pig, bovine, chicken, human, mouse, and rat, OXCT1.

Inmunógeno

Synthetic peptide directed towards the middle region of human OXCT1

Aplicación

Rabbit Anti-OXCT1 (AB2) antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.

Secuencia

Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable