AV48320

Anti-RSU1 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-FLJ31034, Anti-RSP-1, Anti-Ras suppressor protein 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 31 kDa
• reactividad de especies: horse, guinea pig, mouse, dog, human, rat, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_689937
• Nº de acceso UniProt: Q15404
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RSU1(6251)

Descripción

Descripción general

RSU1 codes for a Ras suppressor protein that associates with LIM5 domain of PINCH1 and contributes to adhesion-related functions in cells. It regulates p38 signaling and affects cell survival.
Rabbit Anti-RSU1 antibody recognizes chicken, bovine, human, mouse, rat, zebrafish, and canine RSU1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human RSU1

Aplicación

Rabbit Anti-RSU1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.

Acciones bioquímicas o fisiológicas

RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.

Secuencia

Synthetic peptide located within the following region: PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable