AV47876

Anti-LAB antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-BG:DS00004.9, Anti-CG1264, Anti-DmLab, Anti-Dmel_CG1264, Anti-EfR9, Anti-F121, Anti-F24
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 54 kDa
• reactividad de especies: human, Drosophila
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_476613
• Nº de acceso UniProt: P10105
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: Drosophila melanogaster ... lab(40817)

Descripción

Descripción general

Labial (LAB) is a Drosophila transcription factor that regulates brain, midgut and embryo development. It is also known to modulate cell fate decisions and cell differentiation.
Rabbit Anti-LAB antibody recognizes Drosophila LAB.

Inmunógeno

Synthetic peptide corresponding to a region of Fruit fly

Aplicación

Rabbit Anti-LAB antibody is suitable for western blot applications at a concentration of 1μg/ml and for IHC at 4-8μg/ml.

Acciones bioquímicas o fisiológicas

lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Secuencia

Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable