Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV46789

Sigma-Aldrich

Anti-LMAN2 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-C5orf8, Anti-GP36B, Anti-Lectin, mannose-binding 2, Anti-VIP36

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

40 kDa

reactividad de especies

mouse, dog, rat, human, bovine, horse, rabbit, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... LMAN2(10960)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human LMAN2

Aplicación

Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Acciones bioquímicas o fisiológicas

LMAN2 (Lectin, mannose-binding 2) gene encodes a type I transmembrane lectin protein localized in endoplasmic reticulum, the Golgi apparatus and the plasma membrane. It plays a pivotal role in sorting, trafficking and quality control of secretory proteins and/or lipids.

Secuencia

Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Daisuke Nawa et al.
Glycobiology, 17(9), 913-921 (2007-06-26)
VIP36 is an intracellular lectin that cycles between the endoplasmic reticulum (ER) and the Golgi apparatus, and is thought to act as a cargo receptor in the transport and sorting of glycoproteins. Here we sought to identify the proteins that

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico