AV46636

Anti-TSPAN32 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-MGC22455, Anti-PHEMX, Anti-PHMX, Anti-TSSC6, Anti-Tetraspanin 32
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 31 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_620591
• Nº de acceso UniProt: Q96QS1-2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TSPAN32(10077)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human TSPAN32

Aplicación

Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

TSPAN32 encodes for tetraspanin 32 protein, that belongs to tetraspanin superfamily and is expressed mainly in hematopoietic tissues comprising peripheral blood leukocytes, thymus and spleen. It plays a crucial role in hematopoietic cell function. Additionally, it also facilitates the gulating T cell proliferation responses in vitro. TSSC6 along with CD37 regulates the antipathogen cellular immunity.

Secuencia

Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable