AV46090

Anti-PEX3 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Peroxisomal biogenesis factor 3, Anti-TRG18
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 42 kDa
• reactividad de especies: horse, human, mouse, guinea pig, dog, rabbit, rat, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_003621
• Nº de acceso UniProt: P56589
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PEX3(8504)

Descripción

Descripción general

Peroxisomal biogenesis factor 3 (PEX3, TRG18), a PEX19 docking protin, and PEX19 have key roles in the biogenesis of peroxisomes. Membrane-anchored PEX3 functions as a PEX19 receptor, wherein PEX19 recognizes newly synthesized peroxisomal membrane proteins (PMP) and recruits them to the peroxisomal membrane.

Especificidad

Anti-PEX3 polyclonal antibody reacts with bovine, human, mouse, rat, canine, zebrafish, and chicken peroxisomal biogenesis factor 3 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PEX3

Aplicación

Anti-PEX3 polyclonal antibody is used to tag peroxisomal biogenesis factor 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of peroxisomal biogenesis factor 3 in peroxisome biosynthesis.

Acciones bioquímicas o fisiológicas

PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Secuencia

Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable