Saltar al contenido
Merck
Todas las fotos(2)

Documentos

AV45774

Sigma-Aldrich

Anti-PFKL antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DKFZp686G1648, Anti-DKFZp686L2097, Anti-FLJ30173, Anti-FLJ40909, Anti-PFK-B, Anti-Phosphofructokinase, liver

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

64 kDa

reactividad de especies

rat, mouse, bovine, dog, guinea pig, horse, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_002617

Nº de acceso UniProt

P17858

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PFKL(5211)

Inmunógeno

Synthetic peptide directed towards the middle region of human PFKL

Acciones bioquímicas o fisiológicas

Phosphofructokinase (PFK; ATP: D-fructose-6-phosphate 1-phosphotransferase), the key regulatory enzyme of glycolysis, is a tetrameric protein. Three structural loci encode three distinct PFK units, muscle (PFKM) liver (PFKL), and platelet (PFKP). Each subunit is encoded by a separate gene; except PFKL, which maps to chromosome 21.

Secuencia

Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

R M Kay et al.
The American journal of clinical nutrition, 30(2), 171-175 (1977-02-01)
Citrus pectin (15 g/day) was added for 3 weeks to metabolically controlled diets in nine subjects. Pectin was consumed with fruit and sugar as a gel in divided doses with meals. Plasma cholesterol concentrations were reduced by a mean of
A Elson et al.
The Biochemical journal, 299 ( Pt 2), 409-415 (1994-04-15)
The human liver-type subunit of the key glycolytic enzyme, phosphofructokinase (PFKL), is encoded by a gene residing on chromosome 21. This chromosome, when triplicated, causes the phenotypic expression of Down's syndrome (trisomy 21). Increased phosphofructokinase activity, a result of gene
Daniel B Graham et al.
Nature communications, 6, 7838-7838 (2015-07-22)
The phagocyte oxidative burst, mediated by Nox2 NADPH oxidase-derived reactive oxygen species, confers host defense against a broad spectrum of bacterial and fungal pathogens. Loss-of-function mutations that impair function of the Nox2 complex result in a life-threatening immunodeficiency, and genetic

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico