Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV44247

Sigma-Aldrich

Anti-MICA antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DAQB-48K1.7, Anti-MGC111087, Anti-MHC class I polypeptide-related sequence A, Anti-PERB11.1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

42 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_000238

Nº de acceso UniProt

Q29983

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... MICA(4276)

Inmunógeno

Synthetic peptide directed towards the middle region of human MICA

Aplicación

Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

MHC Class I polypeptide-related sequences A and B (MICA and MICB) are surface glycoproteins expressed constitutively on the enterocytes. They act as ligands for the natural killer group 2, member D (NKG2D) immunoreceptor activation. MICA binds NKG2D receptor and activates the CD8+T cells. Tissue damage or increased expression of MICA results in auto-antibodies detected in early-onset systemic lupus erythematosus and celiac disease.

Secuencia

Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC14301

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Antonio López-Vázquez et al.
BMC medicine, 12, 34-34 (2014-02-26)
Overexpression of autologous proteins can lead to the formation of autoantibodies and autoimmune diseases. MHC class I polypeptide-related sequence A (MICA) is highly expressed in the enterocytes of patients with celiac disease, which arises in response to gluten. The aim
Zhenpeng Dai et al.
The Journal of experimental medicine, 206(4), 793-805 (2009-03-18)
The NKG2D receptor stimulates natural killer cell and T cell responses upon engagement of ligands associated with malignancies and certain autoimmune diseases. However, conditions of persistent NKG2D ligand expression can lead to immunosuppression. In cancer patients, tumor expression and shedding
S Bahram et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(14), 6259-6263 (1994-07-05)
Major histocompatibility complex (MHC) class I genes typically encode polymorphic peptide-binding chains which are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. They constitute diverse gene families in different species and include the numerous so-called
Natasja Nielsen et al.
Immunology, 142(4), 581-593 (2014-03-29)
Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation and synovial hyperplasia leading to progressive joint destruction. Fibroblast-like synoviocytes (FLS) are central components of the aggressive, tumour-like synovial structure termed pannus, which invades the joint space and cartilage.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico