Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV44127

Sigma-Aldrich

Anti-SLC39A12 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FLJ30499, Anti-MGC43205, Anti-MGC51099, Anti-Solute carrier family 39 (Zinc transporter), member 12, Anti-bA570F3.1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

73 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_689938

Nº de acceso UniProt

Q504Y0-3

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... SLC39A12(221074)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLC39A12

Aplicación

Anti-SLC39A12 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

SLC39A12 (ZIP-12) is a zinc transporter protein that is predominantly expressed in brain. Zinc transporters are critical in the maintenance of cellular Zn+2 homeostasis. The expression of ZIP-12 is important for neurulation and development of the central nervous system. It mediates the neurite outgrowth and neuronal differentiation and is required for embryonic viability.

Secuencia

Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Winyoo Chowanadisai et al.
Communicative & integrative biology, 6(6), e26207-e26207 (2014-02-26)
The essentiality of zinc for normal brain development is well established. It has been suggested that primary and secondary zinc deficiencies can contribute to the occurrence of numerous human birth defects, including many involving the central nervous system. In a
Winyoo Chowanadisai et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(24), 9903-9908 (2013-05-30)
Zn(2+) is required for many aspects of neuronal structure and function. However, the regulation of Zn(2+) in the nervous system remains poorly understood. Systematic analysis of tissue-profiling microarray data showed that the zinc transporter ZIP12 (slc39a12) is highly expressed in
Mikael Klingeborn et al.
Scientific reports, 7(1), 4901-4901 (2017-07-09)
The retinal pigmented epithelium (RPE) forms the outer blood-retinal barrier in the eye and its polarity is responsible for directional secretion and uptake of proteins, lipoprotein particles and extracellular vesicles (EVs). Such a secretional division dictates directed interactions between the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico