AV38543

Anti-NRF1 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-ALPHA-PAL, Anti-EWG, Anti-Nuclear respiratory factor 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 56 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001035199
• Nº de acceso UniProt: Q16656
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NRF1(4899)

Descripción

Descripción general

Nuclear respiratory factor 1 (NRF1) is a transcription factor that activates cassettes of metabolic genes that regulate cellular respiratory and oxidative stress genes involved in heme biosynthesis, mitochondrial DNA transcription and replication and antioxidant enzymes. NRF1 and NRF2 function to mediate biogenomic coordination between nuclear and mitochondrial genomes.

The previously assigned protein identifier Q96AN2 has been merged into Q16656. Full details can be found on the UniProt database.

Especificidad

Anti-NRF1 polyclonal antibody reacts with human nuclear respiratory factor 1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human NRF1

Aplicación

Anti-NRF1 polyclonal antibody is used to tag nuclear respiratory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of nuclear respiratory factor 1 in respiratory and antioxidation processes and nuclear, mitochondrial biogenomic coordination.

Acciones bioquímicas o fisiológicas

NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.

Secuencia

Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable