AV37905

Anti-MyBBP1A antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-AL024407, Anti-AU019902, Anti-MyB binding protein (P160) 1a, Anti-P160, Anti-p160MBP, Anti-p67MBP
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 152 kDa
• reactividad de especies: mouse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_058056
• Nº de acceso UniProt: Q7TPV4
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: mouse ... Mybbp1a(18432)

Descripción

Descripción general

MyB binding protein (P160) 1a (MyBBP1A), a c-myb proto-oncogene product (c-Myb)-interacting protein, is post-translationally processed to 67 kDa fragment (p67MBP). MyBBP1A is primarily expressed in the nucleoli. MyBBP1A which is associated with RNA Polymerase 1 complex and ribosome biogenesis machinery regulates rRNA metabolism and is believed to connect the process of ribosome biogenesis and Myb-dependent transcription to regulate/coordinate cell cycle progression and proliferation.

Especificidad

Anti-MyBBP1A polyclonal antibody reacts with human, rat, and mouse MyB binding protein (P160) 1a proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of mouse Mybbp1a

Aplicación

Anti-MyBBP1A polyclonal antibody is used to tag MyB binding protein (P160) 1a protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MyB binding protein (P160) 1a in the coordination and regulation of rRNA biosynthesis and ribosome biogenesis.

Acciones bioquímicas o fisiológicas

Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.

Secuencia

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable