AV37713

Anti-G3BP antibody produced in rabbit

IgG fraction of antiserum

• Número MDL: MFCD02262927
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 51 kDa
• reactividad de especies: dog, bovine, pig, rat, horse, rabbit, human, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_005745
• Nº de acceso UniProt: Q13283
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... G3BP(10146)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human G3BP

Acciones bioquímicas o fisiológicas

G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3′-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Secuencia

Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable