Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV35908

Sigma-Aldrich

Anti-TRIP4 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Thyroid hormone receptor interactor 4

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

66 kDa

reactividad de especies

guinea pig, dog, bovine, mouse, rat, rabbit, human, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_057297

Nº de acceso UniProt

Q15650

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... TRIP4(9325)

Inmunógeno

Synthetic peptide directed towards the middle region of human TRIP4

Acciones bioquímicas o fisiológicas

TRIP4, also referred to as human activating signal cointegrator 1 (hASC-1), is a transcriptional coactivator of nuclear receptors. The ASC-1 complex is a transactivator for NF-κB, AP-1 and SRF signaling. The expression of TRIP4 acts as a marker of disease progression for Alzheimer′s disease.

Secuencia

Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A Ruiz et al.
Translational psychiatry, 4, e358-e358 (2014-02-06)
To follow-up loci discovered by the International Genomics of Alzheimer's Disease Project, we attempted independent replication of 19 single nucleotide polymorphisms (SNPs) in a large Spanish sample (Fundació ACE data set; 1808 patients and 2564 controls). Our results corroborate association
Dong-Ju Jung et al.
Molecular and cellular biology, 22(14), 5203-5211 (2002-06-22)
Human activating signal cointegrator 1 (hASC-1) was originally isolated as a transcriptional coactivator of nuclear receptors. Here we report that ASC-1 exists as a steady-state complex associated with three polypeptides, P200, P100, and P50, in HeLa nuclei; stimulates transactivation by

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico