AV35178

Anti-KCNA10 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Potassium voltage-gated channel, shaker-related subfamily, member 10
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 56 kDa
• reactividad de especies: human, rat, mouse, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_005540
• Nº de acceso UniProt: Q16322
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... KCNA10(3744)

Descripción

Descripción general

KCNA10 codes for a tetrameric protein that belongs to the potassium channel, voltage-gated (shaker-related) family. It is strongly expressed in hair cells of the inner ear in mice. A null mutation in Kcna10 has been linked to vestibular and hearing dysfunctions in mice.
Rabbit Anti-KCNA10 antibody recognizes human, mouse, rat, and chicken KCNA10.

Inmunógeno

Synthetic peptide directed towards the middle region of human KCNA10

Aplicación

Rabbit Anti-KCNA10 antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.

Acciones bioquímicas o fisiológicas

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Secuencia

Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable