AV35033

Anti-ACCN1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Amiloride-sensitive cation channel 1, neuronal (degenerin)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 63 kDa
• reactividad de especies: human, rabbit, dog, rat, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001085
• Nº de acceso UniProt: Q16515-2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ACCN1(40)

Descripción

Descripción general

ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. ACCN1 gene may modulate the aggressiveness of neuroblastoma tumors.
Rabbit Anti-ACCN1 antibody recognizes canine, bovine, human, rat, and mouse ACCN1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ACCN1

Aplicación

Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 μg/ml.

Acciones bioquímicas o fisiológicas

ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Secuencia

Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable