AV34622
Anti-KCNIP4 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-Kv channel interacting protein 4
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
29 kDa
reactividad de especies
mouse, rat, rabbit, human
concentración
0.5 mg - 1 mg/mL
técnicas
immunohistochemistry: suitable
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
Información sobre el gen
human ... KCNIP4(80333)
Descripción general
KCNIP4 is a protein member of the voltage-gated potassium (Kv) channel-interacting family. This protein is known to associate with calcium and presenilin. KCNIP4 has been implicated as a candidate gene for renal cancer, personality and attention-deficit/hyperactivity disorders (PD and ADHD), and asthma.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.
Rabbit Anti-KCNIP4 antibody recognizes human, mouse, rat, bovine, and canine KCNIP4.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human KCNIP4
Aplicación
Rabbit Anti-KCNIP4 antibody is suitable for western blot (1.0 μg/ml) and IHC (4-8 μg/ml) applications.
Acciones bioquímicas o fisiológicas
KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin.
Secuencia
Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Lena Weißflog et al.
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology, 23(6), 436-447 (2012-09-18)
Attention-deficit/hyperactivity disorder (ADHD) is a neurodevelopmental disorder in children with striking persistence into adulthood and a high co-morbidity with other psychiatric disorders, including personality disorders (PD). The 4p15.31 region was shown to be associated with ADHD in several genome wide
Anita Bonne et al.
Cancer genetics and cytogenetics, 179(1), 11-18 (2007-11-06)
Our group and others had previously developed a high throughput procedure to map translocation breakpoints using chromosome flow sorting in conjunction with microarray-based comparative genomic hybridization (arrayCGH). Here we applied both conventional positional cloning and integrated arrayCGH procedures to the
Blanca E Himes et al.
PloS one, 8(2), e56179-e56179 (2013-03-05)
Asthma is a common chronic respiratory disease characterized by airway hyperresponsiveness (AHR). The genetics of asthma have been widely studied in mouse and human, and homologous genomic regions have been associated with mouse AHR and human asthma-related phenotypes. Our goal
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico