Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV34600

Sigma-Aldrich

Anti-CBX8 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Chromobox homolog 8 (Pc class homolog, Drosophila)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

43 kDa

reactividad de especies

human, guinea pig, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_065700

Nº de acceso UniProt

Q9HC52

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CBX8(57332)

Descripción general

CBX8 is a polycomb group protein that associates with other proteins such as TIP60 and MLL-AF9. CBX8 also forms a part of the PRC1 complexes. It regulates fibroblast proliferation and cell survival. Furthermore, studies have reported that CBX8 is needed for MLL-AF9-induced transcription and leukemogenesis.
Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.

Inmunógeno

Synthetic peptide directed towards the middle region of human CBX8

Aplicación

Rabbit Anti-CBX8 (AB1) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.

Acciones bioquímicas o fisiológicas

CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.

Secuencia

Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jiaying Tan et al.
Cancer cell, 20(5), 563-575 (2011-11-19)
Chromosomal translocations involving the mixed lineage leukemia (MLL) gene lead to the development of acute leukemias. Constitutive HOX gene activation by MLL fusion proteins is required for MLL-mediated leukemogenesis; however, the underlying mechanisms remain elusive. Here, we show that chromobox
Nikolaj Dietrich et al.
The EMBO journal, 26(6), 1637-1648 (2007-03-03)
The Polycomb group (PcG) proteins are essential for embryogenesis, and their expression is often found deregulated in human cancer. The PcGs form two major protein complexes, called polycomb repressive complexes 1 and 2 (PRC1 and PRC2) whose function is to

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico