Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

AV31433

Sigma-Aldrich

Anti-POU6F1 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-POU domain, class 6, transcription factor 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

33 kDa

reactividad de especies

rabbit, bovine, mouse, horse, rat, human, dog

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_002693

Nº de acceso UniProt

Q14863

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... POU6F1(5463)

Descripción general

POU6F1 is a POU homeobox containing transcription factor that represses Oct2A-mediated stimulation. POU6F1 has been implicated in cell proliferation and ovarian adenocarcinoma.
Rabbit Anti-POU6F1 (AB1) recognizes human, mouse, rat, canine, zebrafish, and bovine POU6F1

Inmunógeno

Synthetic peptide directed towards the middle region of human POU6F1

Aplicación

Rabbit Anti-POU6F1 (AB1) antibody can be used for immunohistochemistry (4-8μg/ml) and western blot (0.12μg/ml) applications.

Acciones bioquímicas o fisiológicas

The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.

Secuencia

Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

E Wey et al.
Biochemical and biophysical research communications, 220(2), 274-279 (1996-03-18)
Transcription factors of the POU family recognize DNA through their POU domain which represents a bipartite DNA binding motif consisting of a POU specific domain and a POU homeobox. It is thought that both subdomains make specific contacts with DNA
Norihito Yoshioka et al.
Human cell, 22(4), 94-100 (2009-10-31)
Clear cell adenocarcinoma of the ovary often shows resistance to anticancer agents. We investigated new molecules to use when developing molecular-targeting therapy for clear cell adenocarcinoma of the ovary. RMG-I cells without invasive potential and RMG-V cells with invasive potential

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico