AV30060

Anti-ZNF512 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Zinc finger protein 512
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 65 kDa
• reactividad de especies: bovine, guinea pig, human, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_115810
• Nº de acceso UniProt: Q96ME7
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... ZNF512(84450)

Descripción

Descripción general

ZNF512 is a protein that may have four zinc finger motifs that probably interact with nucleic acid or proteins. Rabbit Anti-ZNF512 antibody binds to bovine, human, mouse, and rat ZNF512.

Inmunógeno

Synthetic peptide directed towards the middle region of human ZNF512

Aplicación

Rabbit Anti-ZNF512 antibody can be used for western blot (0.5μg/ml) applications.

Acciones bioquímicas o fisiológicas

ZNF512 is a new candidate transcription factor.

Secuencia

Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable