Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV13019

Sigma-Aldrich

Anti-CHRNA9 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Cholinergic receptor, nicotinic, α-9 (muscle)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

55 kDa

reactividad de especies

guinea pig, horse, human, bovine, dog, rabbit

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_060051

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... CHRNA9(55584)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CHRNA9

Aplicación

Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml.

Acciones bioquímicas o fisiológicas

CHRNA9 is a transmembrane oligomeric ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. The expression of CHRNA9 receptor has been observed to be elevated in human breast epithelial cells during tumorigenesis. CHRNA9 has been implicated in stress-induced functional plasticity of rat adrenal medulla.

Secuencia

Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Claude Colomer et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 30(19), 6732-6742 (2010-05-14)
An increase in circulating adrenal catecholamine levels constitutes one of the mechanisms whereby organisms cope with stress. Accordingly, stimulus-secretion coupling within the stressed adrenal medullary tissue undergoes persistent remodeling. In particular, cholinergic synaptic neurotransmission between splanchnic nerve terminals and chromaffin
Chia-Hwa Lee et al.
Journal of the National Cancer Institute, 102(17), 1322-1335 (2010-08-25)
Large epidemiological cohort studies in the United States have indicated that active and passive smoking are associated with increased breast cancer risk. However, there was no direct evidence of an effect of tobacco carcinogens on the cellular molecules involved in
Inmaculada Posadas et al.
Current neuropharmacology, 11(3), 298-314 (2013-11-02)
Many studies have focused on expanding our knowledge of the structure and diversity of peripheral and central nicotinic receptors. Nicotinic acetylcholine receptors (nAChRs) are members of the Cys-loop superfamily of pentameric ligand-gated ion channels, which include GABA (A and C)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico