APREST95461

PrEST Antigen RHCE

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• Sinónimos: CD240CE, RH
• UNSPSC Code: 12352203
• Uniprot accession no.: P18577
• Species reactivity: -
• Application: —
• Citations: -

Propiedades

• recombinant: expressed in E. coli
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 21 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• sequence note: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
• Ensembl | human accession no.: ENSG00000188672
• UniProt accession no.: P18577
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... RHCE(6006)

Descripción

General description

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Application

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

Store at -20°C. Avoid repeated freeze/thaw cycles.

Other Notes

Corresponding Antibodies HPA077385

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Clase de almacenamiento: 12 - Non Combustible Liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable