APREST95144

PrEST Antigen C12orf54

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• Sinónimos: MGC35033
• Código UNSPSC: 12352203

Propiedades

• recombinante: expressed in E. coli
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Análisis: >80% (SDS-PAGE)
• formulario: buffered aqueous solution
• mol peso: predicted mol wt 25 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentración: ≥0.5 mg/mL
• nota de secuencia: MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR
• Ensembl | nº de acceso humano: ENSG00000177627
• Nº de acceso UniProt: Q6X4T0
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... C12orf54(121273)

Descripción

Descripción general

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Aplicación

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Ligadura / enlace

Corresponding Antibodies HPA073090

Forma física

Solution in 1 M urea-PBS, pH 7.4

Almacenamiento y estabilidad

Store at -20°C. Avoid repeated freeze/thaw cycles.

Otras notas

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable