APREST91410

PrEST Antigen CEACAM19

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinónimos: CEAL1
• Código UNSPSC: 12352202

Propiedades

• recombinante: expressed in E. coli
• Análisis: >80% (SDS-PAGE)
• formulario: buffered aqueous solution
• mol peso: predicted mol wt 30 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentración: ≥0.5 mg/mL
• secuencia del inmunógeno: PQKNQDLLLSVQGVPDTFQDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPT
• Ensembl | nº de acceso humano: ENSG00000186567
• Nº de acceso UniProt: Q7Z692
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... CEACAM19(56971)

Descripción

Descripción general

Recombinant protein fragment of Human CEACAM19 with N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Aplicación

Blocking agent and positive assay control using corresponding antibodies.

Ligadura / enlace

Corresponding Antibody HPA052865.

Forma física

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota de preparación

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable