APREST79990

PrEST Antigen ADCY2

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinónimos: AC2, HBAC2, KIAA1060
• Código UNSPSC: 12352202

Propiedades

• recombinante: expressed in E. coli
• Análisis: >80% (SDS-PAGE)
• formulario: buffered aqueous solution
• mol peso: predicted mol wt 25 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentración: ≥0.5 mg/mL
• secuencia del inmunógeno: HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
• Ensembl | nº de acceso humano: ENSG00000078295
• Nº de acceso UniProt: Q08462
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... ADCY2(108)

Descripción

Descripción general

Recombinant protein fragment of Human ADCY2 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicación

Suitable as a blocking agent using corresponding antibodies.

Ligadura / enlace

Corresponding Antibody HPA038483.

Forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparación

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable